PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003488.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 691aa    MW: 78909.9 Da    PI: 7.0555
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003488.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR133.41.5e-10136185151
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkkteke 51 
                              +fY++YAk vGF+vr  +++k+ r ge+  + +vCs+eg++   k+k++++
  Itr_sc003488.1_g00005.1 136 EFYKAYAKAVGFDVRHGTMRKT-RGGEVAIKYMVCSREGFKPAAKEKNSQK 185
                              6*****************9999.8888999**********99988873333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.7E-8136189IPR004330FAR1 DNA binding domain
PfamPF105512.1E-30238330IPR018289MULE transposase domain
PROSITE profilePS509669.891491527IPR007527Zinc finger, SWIM-type
PfamPF044348.9E-6498525IPR007527Zinc finger, SWIM-type
SMARTSM005755.2E-5502529IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MVANSKVVVS RVVDIGLVRA VLMCSVVAAN MVCMVVVVAR CEPWWPQWSL EGLVYVYTTL  60
PSRMNVEFEQ GYSETMEANS ADMWENNSGS EENGVQETEC EMEISPNGAK QWIPTANPEE  120
TPYTGQKFKT VDEGIEFYKA YAKAVGFDVR HGTMRKTRGG EVAIKYMVCS REGFKPAAKE  180
KNSQKGADAQ MVVEDLFKMK EMNLDFYFDF DLGDGGELCR LFWVDGTSRK NFACFGDVMS  240
FDATYRTNKY RLVFVPFTGV DHHKRCITFG AGLLAKEDVE SYEWLLTSFK NAMGATPRCA  300
ITDQDAALKV AMPNIMPTTR HRFCMWHIMS KVGDKAGNKW LKLMEDYNLV EDRWFAQLYD  360
ARASWIPAYF HDIFMGGLLK TTSRSESENS YFGNFTNHHC SLVEFFMQYN SAIEQQRYKQ  420
NKLNVECEGS FPETKTPLHM EQQATTLYTI NMFYEFQTEI WEGSFTCHII HKKDSIDART  480
YTVQEKGGKA FDVIMHTNGE KIECTCKKFI RVGILCRHAL LVFNSEGVEE IPGEYIVPRW  540
TRDACVRPMH NIWWAKGVNT QADNEAQSLA NQLWNEFYNC MGLVNGWQEK MNEMLTTLQQ  600
LKKEFHKSKL QTNQSPASES TIEAIVGSRT TGEILIKPPK FAHNKGSGKR LKSNKEKAIE  660
KSKKKSRTCA TCDGKGHNSR TCIENRTDFS D
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.18e-67FAR1-related sequence 5